DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand1 and Fer1

DIOPT Version :9

Sequence 1:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:131 Identity:42/131 - (32%)
Similarity:67/131 - (51%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    74 PDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRL 138
            |.:|.|..|.||:. .|::.:::.:...:||||.:|||.||..||..||.:|.:.:|||:.||:|
  Fly    67 PFSRRSHKPRRLKC-ASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKL 130

Mouse   139 ATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRELPQQPESFPPASGPGEKRIKGRT 203
            |.|||.:|.:::.||....:|..              ..:|...::|        |.:..:|.||
  Fly   131 AISYITFLSEMVKKDKNGNEPGL--------------SLQRNYQKEP--------PKKIILKDRT 173

Mouse   204 G 204
            |
  Fly   174 G 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 11/34 (32%)
HLH 103..152 CDD:197674 25/48 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 4/37 (11%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.