DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSD and Bace

DIOPT Version :9

Sequence 1:NP_001900.1 Gene:CTSD / 1509 HGNCID:2529 Length:412 Species:Homo sapiens
Sequence 2:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster


Alignment Length:403 Identity:177/403 - (43%)
Similarity:237/403 - (58%) Gaps:45/403 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    13 LLAAPASA-LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPV-SKYS-QAVPAVTEGPIPEVLKNY 74
            ||||.||| |.|:|:.|..:..:|...|      |..|..: :||. .::.:|.|    |.|.|.
  Fly    10 LLAALASAELHRVPILKEQNFVKTRQNV------LAEKSYLRTKYQLPSLRSVDE----EQLSNS 64

Human    75 MDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFD 139
            |:..|||.|.||||.|.|.|:||:|||||||||..||  ..||..|::|:|..|||||.||.||.
  Fly    65 MNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCK--SDACLTHNQYDSSASSTYVANGESFS 127

Human   140 IHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYP 204
            |.||:|||:||||.|||.|           .|:.::.|.|.|:|.:||..|..|.|||||||||.
  Fly   128 IQYGTGSLTGYLSTDTVDV-----------NGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYE 181

Human   205 RISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAY 269
            .::|:.|.|.|.|::.|.|||.::|||||:||..:..||||:.||:|:..|.|:|:|:.::.:.|
  Fly   182 SLAVDGVAPPFYNMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGY 246

Human   270 WQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVST 334
            ||..:....: .|.:|| :.|:||.||||||:|.|.:....|.:.:.    :..:..:.|..||:
  Fly   247 WQFTMAGSSI-DGYSLC-DDCQAIADTGTSLIVAPYNAYITLSEILN----VGEDGYLDCSSVSS 305

Human   335 LPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGF--MGMDIPPPSGPLWILGDVFIGRYYTVF 397
            ||.:|..:||..:.|.|..|.  :...|.  |:|.|  ||.|       .|||||||||:|||.|
  Fly   306 LPDVTFNIGGTNFVLKPSAYI--IQSDGN--CMSAFEYMGTD-------FWILGDVFIGQYYTEF 359

Human   398 DRDNNRVGFAEAA 410
            |..|||:|||..|
  Fly   360 DLGNNRIGFAPVA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSDNP_001900.1 A1_Propeptide 22..49 CDD:400357 6/26 (23%)
Cathepsin_D2 73..408 CDD:133157 154/336 (46%)
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 155/339 (46%)
Asp 68..371 CDD:278455 153/332 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.