DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSB and CtsL4

DIOPT Version :10

Sequence 1:NP_001899.1 Gene:CTSB / 1508 HGNCID:2527 Length:339 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CtsL4 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:104 Identity:25/104 - (24%)
Similarity:34/104 - (32%) Gaps:32/104 - (30%)


- Green bases have known domain annotations that are detailed below.


Human  1259 NNLGQRLFGETILGLTQGSVSDLLARPKPWHKL---------------------SLKGREPFVRM 1302
            ||.|.....|::..|       .|.:..|:||.                     ||:|.|  :..
  Fly    24 NNAGDHRNNESLAAL-------CLEKTPPFHKWYFETRGRSNKQDKKKGRDHAHSLRGIE--IEE 79

Human  1303 QLWLNDPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCE 1341
            ....||..||.:..:.. .|...|:.||..| ..||..|
  Fly    80 HRKSNDRGNVTECSNAS-SESATYVPRRGRS-GGSQSIE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSBNP_001899.1 Propeptide_C1 26..65 CDD:462365
Peptidase_C1A_CathepsinB 81..328 CDD:239111
CtsL4NP_609387.1 Inhibitor_I29 36..96 CDD:462410 13/68 (19%)
Peptidase_C1A 128..336 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.