DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTSB and CG5367

DIOPT Version :9

Sequence 1:NP_001371643.1 Gene:CTSB / 1508 HGNCID:2527 Length:339 Species:Homo sapiens
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:383 Identity:88/383 - (22%)
Similarity:144/383 - (37%) Gaps:116/383 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     1 MWQL--WASLC---CLLVLAN--------ARSRPSFHPLS-----------DELVNY-------- 33
            ||:|  :..||   |.:|.:|        |..:..|....           ||:.:|        
  Fly     1 MWKLIFFGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFK 65

Human    34 -VNKRNTTWQAGHNFYNV------DMS---YLK---RL-----------CGTFLGGPKPPQRVMF 74
             :.:.|..::.|...:.:      |||   |||   ||           ....:|.|     :| 
  Fly    66 VIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSP-----LM- 124

Human    75 TEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLL 139
               ..:|.|.|.|.:....|...::    |||||:||...|:|..::...|...:|  :|.:.::
  Fly   125 ---ANVPESLDWRSKGFITPPYNQL----SCGSCYAFSIAESIMGQVFKRTGKILS--LSKQQIV 180

Human   140 TCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDT 204
            .|..|....||.||......::...    :||:....                 ..|....:|  
  Fly   181 DCSVSHGNQGCVGGSLRNTLSYLQS----TGGIMRDQ-----------------DYPYVARKG-- 222

Human   205 PKCSKICEPGYSPTYKQDKHYGYNSYSV--SNSEKDIMAEIYKNGPVEGAFSVYSD---FLLYKS 264
             ||..:  |..|..       ...|:::  ...|:.|.|.:...|||  |.|:.:.   |.||..
  Fly   223 -KCQFV--PDLSVV-------NVTSWAILPVRDEQAIQAAVTHIGPV--AISINASPKTFQLYSD 275

Human   265 GVYQH-VTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGI 321
            |:|.. :.......||:.::|:|.:    ||::.|.|..:||:||:.:|.:|.:.|||
  Fly   276 GIYDDPLCSSASVNHAMVVIGFGKD----YWILKNWWGQNWGENGYIRIRKGVNMCGI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTSBNP_001371643.1 Propeptide_C1 26..65 CDD:400445 13/81 (16%)
Peptidase_C1A_CathepsinB 81..328 CDD:239111 62/247 (25%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 9/59 (15%)
Peptidase_C1A 128..336 CDD:239068 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.