DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHETA2 and pheta2

DIOPT Version :9

Sequence 1:NP_001002034.2 Gene:PHETA2 / 150368 HGNCID:27161 Length:259 Species:Homo sapiens
Sequence 2:XP_004913853.1 Gene:pheta2 / 100488560 XenbaseID:XB-GENE-985681 Length:256 Species:Xenopus tropicalis


Alignment Length:270 Identity:117/270 - (43%)
Similarity:149/270 - (55%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLS 65
            |||||||:||||.|.||||..|:|...|...|      ..::.||||||||||.||.:..:.|:.
 Frog     1 MKLNERSMAHYATSGSPADCTGYLYKRGVKHT------AYQKRWFVLKGNLLFYFEEQGNKEPVG 59

Human    66 LVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRE 130
            :||||||.:||..:  .||.||.:.||.||.|.::||||.....|.|||.||||||.||||||||
 Frog    60 VVVLEGCAIELCHS--NEEHAFCVRFDGPGSRSYILAAETQEEMECWVKALSRASFDYMRLVVRE 122

Human   131 LESQLQDARQSLALQRRSSWKSVASRC--KPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGS--- 190
            ||.|| :..|..:::|:.......||.  :.:..|.|...|.||....:|::.......:||   
 Frog   123 LERQL-ELMQKTSIRRKPGRHRGRSRAVSRTKWENSRPPELCNGFLHPEDTNLETHTRVSGSSIP 186

Human   191 -----------RSAGW--GLAEWELQ-GPASLLLGKGQSPVSPETSCFSTLHDWYGQEIVELRQC 241
                       |.|.|  |.:...:. .|.|:     :|||.|.|.|||.||:|||:|:.|||:.
 Frog   187 PPLPPPLPPRRRGAAWVNGASSASMPVSPVSV-----ESPVCPGTFCFSKLHEWYGKEVEELRKA 246

Human   242 WQKRAQGSHS 251
            |||. |.|.|
 Frog   247 WQKE-QRSES 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHETA2NP_001002034.2 PH-like 11..138 CDD:327399 67/126 (53%)
F&H 223..235 8/11 (73%)
pheta2XP_004913853.1 PH_Ses 11..130 CDD:270105 67/127 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I36579
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1329965at2759
OrthoFinder 1 1.000 - - FOG0003195
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22902
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.110

Return to query results.
Submit another query.