DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHADL and Fili

DIOPT Version :9

Sequence 1:XP_011528235.1 Gene:CHADL / 150356 HGNCID:25165 Length:830 Species:Homo sapiens
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:641 Identity:151/641 - (23%)
Similarity:224/641 - (34%) Gaps:165/641 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   135 LDLQGNLLKVIPAAAFQGVPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASNHLRELPQEALD 199
            |||..|:::.:.:..|:....|..|:|....|..:.:.||:||..||||:|:.|.:..:...||.
  Fly   101 LDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLSFNRIETVHPTALS 165

Human   200 GLGSLRRLELEGNALEELRPGTFGALGALATLNLAHNALVYLPAM-------------------- 244
            .|.||..|:|..|.:..|....|..:..|..|...:|.|:.:||.                    
  Fly   166 DLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEF 230

Human   245 ----AFQGLLRVRWLRLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGPVLSQARGLARLEL 305
                :|:||..:..|.:..|.:|.|...|..||.:|:.|.|..|.|..:|...||:...|..|.|
  Fly   231 VRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNL 295

Human   306 GHNPLTYAGEEDGLALPGLRELLLDG-GALQALGPRAFAHCPRLHTLDL---------------- 353
            |.|..:.......|.|..||||.|.. ..||.:..|||.....|.||.|                
  Fly   296 GGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQG 360

Human   354 ---------RGNQLDTLPPLQGP-GQLRRLRLQGNPLWCGCQARPLLEWLARARVRS-DGACQGP 407
                     :.|.|.||...|.| .||::|.|..|||.|.|.    |.||.|....: :|...|.
  Fly   361 NPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCS----LLWLWRLVTGNFEGVDPGM 421

Human   408 RRLRGEALDALRPWDLRCPGDAAQE--EEELEERAVAGPRAPPRGPPRGPGEERAVAPCPRACVC 470
            ....|.|:.||           |:|  :|||.:.|.|           ....:..||    |...
  Fly   422 EHAAGGAVAAL-----------AKEADDEELADEATA-----------VASTDDGVA----ALAA 460

Human   471 VPESRHSSCEGCGLQAVPRGFPSDTQLLDLRRNHFPSVPRAAFPGLG------------------ 517
            ....:|.      :.|:....||..:|.....|....:.|.....:|                  
  Fly   461 YIAEQHI------VNALHTTEPSAYELATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMS 519

Human   518 --------HLVSLHLQHCGIAELEAGALAGLGRLIYLYLSDNQLAGLSAAALEGAPRLGYLYLER 574
                    |:|::   .|.:......|:.|:..|.||                       .:::|
  Fly   520 EGEITCPAHIVTV---VCAVITCLLVAMIGISVLYYL-----------------------RFVKR 558

Human   575 NRFLQVPGAALRALPSLFSLHLQDNAVDRLAPGDLGRTRALRWVYLSGNRITEVSLGALGPAREL 639
            .|.|......:|...|:.::|  |..:....||.||  ..:......||.:..:.: .|......
  Fly   559 RRKLLHERGPMRTSKSIINVH--DRILQGHNPGGLG--LGMSMTLGGGNHVNGLGM-TLNYPHHA 618

Human   640 EKLHLDRNQLREVPTGALEG----------LPALLELQLS--------GNPLRALR 677
            :.|....:..:.:|..:..|          ||.|.:|:|.        .|..|||:
  Fly   619 QTLQAHHHYHQAMPLQSHGGNGNHEYQQTTLPQLDKLELERYLAAQTIANEYRALK 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHADLXP_011528235.1 leucine-rich repeat 132..155 CDD:275380 5/19 (26%)
LRR_RI <133..358 CDD:238064 75/272 (28%)
LRR_8 133..214 CDD:290566 27/78 (35%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..203 CDD:275380 9/22 (41%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
LRR_8 228..286 CDD:290566 20/81 (25%)
leucine-rich repeat 228..251 CDD:275380 9/46 (20%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
leucine-rich repeat 276..299 CDD:275380 8/22 (36%)
leucine-rich repeat 300..323 CDD:275380 7/22 (32%)
LRR_8 322..380 CDD:290566 25/84 (30%)
leucine-rich repeat 324..347 CDD:275380 10/23 (43%)
LRR_4 346..>380 CDD:289563 15/59 (25%)
LRRNT 463..497 CDD:214470 5/33 (15%)
leucine-rich repeat 478..494 CDD:275380 2/15 (13%)
LRR_RI 492..671 CDD:238064 36/222 (16%)
leucine-rich repeat 495..518 CDD:275380 4/48 (8%)
LRR_8 518..577 CDD:290566 9/58 (16%)
leucine-rich repeat 519..542 CDD:275380 4/22 (18%)
leucine-rich repeat 543..566 CDD:275380 3/22 (14%)
LRR_8 565..625 CDD:290566 13/59 (22%)
leucine-rich repeat 567..590 CDD:275380 4/22 (18%)
leucine-rich repeat 591..614 CDD:275380 6/22 (27%)
leucine-rich repeat 615..638 CDD:275380 3/22 (14%)
LRR_8 637..698 CDD:290566 12/59 (20%)
leucine-rich repeat 639..662 CDD:275380 4/32 (13%)
leucine-rich repeat 663..687 CDD:275380 7/23 (30%)
LRR_8 686..745 CDD:290566
leucine-rich repeat 688..712 CDD:275380
LRR_4 711..>744 CDD:289563
LRRCT 743..791 CDD:214507
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378
leucine-rich repeat 98..121 CDD:275380 5/19 (26%)
LRR_8 120..180 CDD:404697 22/59 (37%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 9/22 (41%)
LRR <161..>354 CDD:227223 55/192 (29%)
leucine-rich repeat 170..193 CDD:275380 6/22 (27%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..265 CDD:275380 10/46 (22%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
leucine-rich repeat 314..338 CDD:275380 10/23 (43%)
LRR_8 337..397 CDD:404697 15/59 (25%)
leucine-rich repeat 339..360 CDD:275380 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.