DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB7 and mrj

DIOPT Version :10

Sequence 1:NP_660157.1 Gene:DNAJB7 / 150353 HGNCID:24986 Length:309 Species:Homo sapiens
Sequence 2:NP_725545.2 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:338 Identity:89/338 - (26%)
Similarity:131/338 - (38%) Gaps:140/338 - (41%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSN------- 58
            |||||::|.:.|.|:..::||||.|:||||||||||:|.:||.::|:|::|||||||:       
  Fly     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIY 65

Human    59 ----------------------------------------------------------------- 58
                                                                             
  Fly    66 DARATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAF 130

Human    59 ---------------DEKRDIYDKYGTEGLNGGG---SH---------FDDECEYG---FTFHKP 93
                           ::||.|||:||.:||...|   ||         |||....|   |.|..|
  Fly   131 TFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPP 195

Human    94 DDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRN----------------RDAGYFFSTAS 142
            ::||:|.|....||:..|.:.:.....:..|||...||                :.|..|.:...
  Fly   196 EEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNGGSSGSSRHHHHHHQHKVASPFGAPML 260

Human   143 EYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDN--SGMDNYIS--------VTTSDKIVNGR 197
            .|.:.:.|            :...|.|||||:...|  ||:.:..|        .:||...|||:
  Fly   261 NYSMMDFF------------MPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRTSTSTVFVNGK 313

Human   198 NINTKKIIESDQE 210
            .:.||:::|:.:|
  Fly   314 KLMTKRVVENGKE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB7NP_660157.1 PRK10767 3..>101 CDD:236757 55/199 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..309
mrjNP_725545.2 DnaJ 3..66 CDD:395170 33/62 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.