DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP18 and Mkp

DIOPT Version :10

Sequence 1:NP_689724.3 Gene:DUSP18 / 150290 HGNCID:18484 Length:188 Species:Homo sapiens
Sequence 2:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster


Alignment Length:130 Identity:28/130 - (21%)
Similarity:48/130 - (36%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   195 CALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETLLAKLIQTCQHVEVNASRQE 259
            ||.||.:  .|..|...:...|....|..:....:.:...:.:..||.:|..:.:...||:...|
  Fly    10 CAACKFL--RRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPSQREDAVNSLAYE 72

Human   260 AKL-----TEECDLLIEIIQQRRQIIGTKIKEGKVIRLRKLAQQIANCKQCLERSASL-ISQAEH 318
            |.:     ...|..:|.::|.               :||:|...::..|..|.:..|| |..|.|
  Fly    73 ADMRLRDPVYGCVGVISLLQH---------------QLRQLQIDLSCAKSELSKYQSLGILAATH 122

Human   319  318
              Fly   123  122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP18NP_689724.3 DUSP18_21 19..176 CDD:350421
MkpNP_001036572.1 DSP 66..201 CDD:350348 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.