DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTNND2 and VAC8

DIOPT Version :9

Sequence 1:XP_005248308.1 Gene:CTNND2 / 1501 HGNCID:2516 Length:1250 Species:Homo sapiens
Sequence 2:NP_010903.3 Gene:VAC8 / 856702 SGDID:S000000739 Length:578 Species:Saccharomyces cerevisiae


Alignment Length:452 Identity:97/452 - (21%)
Similarity:176/452 - (38%) Gaps:135/452 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   565 SVQSNAAAYLQHLCFGD--NKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDD 627
            ::|.:||     |.|.:  .|...::.|: .::.::.||..:..::..:||.||.||.   .|::
Yeast    62 NLQRSAA-----LAFAEITEKYVRQVSRE-VLEPILILLQSQDPQIQVAACAALGNLA---VNNE 117

Human   628 NKIALKNCGGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSG 692
            ||:.:...||:..|:..: ...::|::....|.:.||::.|..|..|       .|:..:||   
Yeast   118 NKLLIVEMGGLEPLINQM-MGDNVEVQCNAVGCITNLATRDDNKHKI-------ATSGALIP--- 171

Human   693 WENSPLQDDRKIQLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEID 757
              .:.|...:.|     :|.|||||.|.|::.: ||.|:.:     :....:.|:.|.|.|::.|
Yeast   172 --LTKLAKSKHI-----RVQRNATGALLNMTHS-EENRKEL-----VNAGAVPVLVSLLSSTDPD 223

Human   758 SKTVENCVCILRNLSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQW 822
            .                        |:..|..|..:...|||              :||.:|.: 
Yeast   224 V------------------------QYYCTTALSNIAVDEAN--------------RKKLAQTE- 249

Human   823 DGVGPLPDCAEPPKGIQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKGWAEDVAG 887
                                 |.:|...::|:...|:....: |..||:|||:.:          
Yeast   250 ---------------------PRLVSKLVSLMDSPSSRVKCQ-ATLALRNLASDT---------- 282

Human   888 MAYALRSLPEGAPCLPQWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKE 952
             :|.|..:..|                   |||.||:|::.|:..:|.|....:||:::...|:.
Yeast   283 -SYQLEIVRAG-------------------GLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEG 327

Human   953 LIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEK 1014
            ||........:.||....:|......|:|         ||..:...:.:|.|...::|.:||
Yeast   328 LIVDAGFLKPLVRLLDYKDSEEIQCHAVS---------TLRNLAASSEKNRKEFFESGAVEK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTNND2XP_005248308.1 ARM 544..666 CDD:237987 25/102 (25%)
armadillo repeat 552..577 CDD:293788 3/11 (27%)
armadillo repeat 585..621 CDD:293788 9/35 (26%)
armadillo repeat 629..664 CDD:293788 6/34 (18%)
armadillo repeat 671..722 CDD:293788 14/50 (28%)
Arm 834..875 CDD:278915 9/40 (23%)
armadillo repeat 838..875 CDD:293788 9/36 (25%)
armadillo repeat 910..944 CDD:293788 10/33 (30%)
ARM 911..1043 CDD:237987 26/104 (25%)
armadillo repeat 951..997 CDD:293788 9/45 (20%)
armadillo repeat 1003..1038 CDD:293788 4/12 (33%)
CAF20 <1054..1113 CDD:293657
VAC8NP_010903.3 SRP1 42..>358 CDD:227396 90/428 (21%)
armadillo repeat 119..155 CDD:293788 8/36 (22%)
armadillo repeat 160..194 CDD:293788 14/50 (28%)
armadillo repeat 204..235 CDD:293788 8/59 (14%)
armadillo repeat 242..280 CDD:293788 12/60 (20%)
armadillo repeat 286..319 CDD:293788 12/51 (24%)
armadillo repeat 326..361 CDD:293788 9/43 (21%)
armadillo repeat 369..402 CDD:293788 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.