Sequence 1: | XP_011527774.1 | Gene: | IGSF5 / 150084 | HGNCID: | 5952 | Length: | 497 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
Alignment Length: | 219 | Identity: | 53/219 - (24%) |
---|---|---|---|
Similarity: | 93/219 - (42%) | Gaps: | 32/219 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 143 GSQARFNCTVSQGWK---LIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVE 204
Human 205 PSDSGNIRCSLQNSRLHG-SAYLTVQVMGELFI---PSVNLVVAENEPCEVTCLPSHWTRLPDIS 265
Human 266 WEL---GLLVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRC 327
Human 328 PQDTGGGINIPGVLSSLPSLGFSL 351 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
IGSF5 | XP_011527774.1 | IG_like | 135..228 | CDD:214653 | 26/88 (30%) |
Ig | <200..230 | CDD:299845 | 8/30 (27%) | ||
Ig | 236..307 | CDD:299845 | 15/76 (20%) | ||
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 26/90 (29%) |
FR1 | 37..50 | CDD:409353 | 2/6 (33%) | ||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 5/14 (36%) | ||
Ig strand C' | 68..72 | CDD:409353 | 2/3 (67%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 11/32 (34%) | ||
Ig strand D | 84..90 | CDD:409353 | 4/6 (67%) | ||
Ig strand E | 94..102 | CDD:409353 | 2/8 (25%) | ||
Ig strand F | 108..115 | CDD:409353 | 2/6 (33%) | ||
CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
FR4 | 124..130 | CDD:409353 | 2/5 (40%) | ||
Ig strand G | 124..130 | CDD:409353 | 2/5 (40%) | ||
Ig_3 | 134..208 | CDD:404760 | 17/82 (21%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 6/23 (26%) | ||
Ig strand C | 256..260 | CDD:409353 | |||
Ig strand E | 286..290 | CDD:409353 | |||
Ig strand F | 300..305 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143418 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |