DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTNNB1 and URK1

DIOPT Version :10

Sequence 1:NP_001895.1 Gene:CTNNB1 / 1499 HGNCID:2514 Length:781 Species:Homo sapiens
Sequence 2:NP_014409.1 Gene:URK1 / 855746 SGDID:S000005295 Length:501 Species:Saccharomyces cerevisiae


Alignment Length:86 Identity:20/86 - (23%)
Similarity:37/86 - (43%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   192 PQMVSAIVRTMQNTNDVETARCTAGTLHNL-SHHREGLLAIFKSGGIPALVKMLGSPVDSVL--- 252
            |..|..:..||:|.:.:..:.....|..|| .:|.:..|.:..:..:..|:|:..||...||   
Yeast   221 PNAVKFVKPTMKNADAIIPSMSDNATAVNLIINHIKSKLELKSNEHLRELIKLGSSPSQDVLNRN 285

Human   253 -------FYAITTLHNLLLHQ 266
                   ...:.:||.:||::
Yeast   286 IIHELPPTNQVLSLHTMLLNK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTNNB1NP_001895.1 Interaction with VCL. /evidence=ECO:0000250 2..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..57
CTNNAbd_CTNNB1 78..151 CDD:439241
SRP1 142..>431 CDD:227396 20/86 (23%)
ARM 1 151..191
armadillo repeat 153..178 CDD:293788
Interaction with BCL9. /evidence=ECO:0000269|PubMed:17052462 156..178
armadillo repeat 188..221 CDD:293788 6/28 (21%)
ARM 2 193..234 9/41 (22%)
armadillo repeat 230..262 CDD:293788 8/41 (20%)
ARM 230..262 CDD:214547 8/41 (20%)
ARM 3 235..276 10/42 (24%)
armadillo repeat 270..306 CDD:293788
ARM 4 277..318
armadillo repeat 312..347 CDD:293788
ARM 5 319..360
ARM 350..390 CDD:214547
armadillo repeat 354..389 CDD:293788
ARM 6 361..389
ARM 7 400..441
armadillo repeat 402..427 CDD:293788
Arm 431..473 CDD:425727
armadillo repeat 435..473 CDD:293788
ARM 8 442..484
armadillo repeat 482..517 CDD:293788
ARM 9 489..530
armadillo repeat 524..582 CDD:293788
ARM 10 531..571
Arm 583..622 CDD:425727
armadillo repeat 587..621 CDD:293788
ARM 11 594..636
armadillo repeat 629..662 CDD:293788
ARM 12 637..666
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..781
Interaction with SCRIB. /evidence=ECO:0000250 772..781
URK1NP_014409.1 udk 69..260 CDD:272977 9/38 (24%)
PRTases_typeI 292..474 CDD:444823 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.