DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTNNB1 and DAS2

DIOPT Version :10

Sequence 1:NP_001895.1 Gene:CTNNB1 / 1499 HGNCID:2514 Length:781 Species:Homo sapiens
Sequence 2:NP_010303.3 Gene:DAS2 / 851583 SGDID:S000002427 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:22/77 - (28%)
Similarity:32/77 - (41%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   626 EAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAW 690
            |..:.||.....|.|  ::.|.||.:   ..|||........:|.|.::....|::..|  |..|
Yeast   157 EMQQYIEPTRTFADL--IIPSTNENL---GRAVLVDGIVKAIEDTKSQIEGNNTNNKIR--PRLW 214

Human   691 N---ETADLGLD 699
            :   ||.||..|
Yeast   215 DFEAETMDLEKD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTNNB1NP_001895.1 Interaction with VCL. /evidence=ECO:0000250 2..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..57
CTNNAbd_CTNNB1 78..151 CDD:439241
SRP1 142..>431 CDD:227396
ARM 1 151..191
armadillo repeat 153..178 CDD:293788
Interaction with BCL9. /evidence=ECO:0000269|PubMed:17052462 156..178
armadillo repeat 188..221 CDD:293788
ARM 2 193..234
armadillo repeat 230..262 CDD:293788
ARM 230..262 CDD:214547
ARM 3 235..276
armadillo repeat 270..306 CDD:293788
ARM 4 277..318
armadillo repeat 312..347 CDD:293788
ARM 5 319..360
ARM 350..390 CDD:214547
armadillo repeat 354..389 CDD:293788
ARM 6 361..389
ARM 7 400..441
armadillo repeat 402..427 CDD:293788
Arm 431..473 CDD:425727
armadillo repeat 435..473 CDD:293788
ARM 8 442..484
armadillo repeat 482..517 CDD:293788
ARM 9 489..530
armadillo repeat 524..582 CDD:293788
ARM 10 531..571
Arm 583..622 CDD:425727
armadillo repeat 587..621 CDD:293788
ARM 11 594..636 3/9 (33%)
armadillo repeat 629..662 CDD:293788 10/32 (31%)
ARM 12 637..666 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..781
Interaction with SCRIB. /evidence=ECO:0000250 772..781
DAS2NP_010303.3 NK 12..196 CDD:450170 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.