DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTNNB1 and CG12016

DIOPT Version :10

Sequence 1:NP_001895.1 Gene:CTNNB1 / 1499 HGNCID:2514 Length:781 Species:Homo sapiens
Sequence 2:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster


Alignment Length:127 Identity:26/127 - (20%)
Similarity:43/127 - (33%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    49 KGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQ 113
            ||.....:.....|.|...:.::|.|.|:.      ||.....::....::        |.|..|
  Fly    94 KGRHVAPEPQEHLVTYANFEHYAQQFQQQY------QYNANYYKQANGGVY--------QYPPQQ 144

Human   114 FDAAHPTNVQRLAEPSQMLKHAV-VNLINYQDDAELATRAI-------------PELTKLLN 161
            ....||.:.|...:..|:.:... :..||.|..|:|..:.:             |||..|.|
  Fly   145 HPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQLRDKKVNFLLVEGFMIFNQPELLALCN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTNNB1NP_001895.1 Interaction with VCL. /evidence=ECO:0000250 2..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..57 2/7 (29%)
CTNNAbd_CTNNB1 78..151 CDD:439241 14/73 (19%)
SRP1 142..>431 CDD:227396 8/33 (24%)
ARM 1 151..191 5/24 (21%)
armadillo repeat 153..178 CDD:293788 5/22 (23%)
Interaction with BCL9. /evidence=ECO:0000269|PubMed:17052462 156..178 3/6 (50%)
armadillo repeat 188..221 CDD:293788
ARM 2 193..234
armadillo repeat 230..262 CDD:293788
ARM 230..262 CDD:214547
ARM 3 235..276
armadillo repeat 270..306 CDD:293788
ARM 4 277..318
armadillo repeat 312..347 CDD:293788
ARM 5 319..360
ARM 350..390 CDD:214547
armadillo repeat 354..389 CDD:293788
ARM 6 361..389
ARM 7 400..441
armadillo repeat 402..427 CDD:293788
Arm 431..473 CDD:425727
armadillo repeat 435..473 CDD:293788
ARM 8 442..484
armadillo repeat 482..517 CDD:293788
ARM 9 489..530
armadillo repeat 524..582 CDD:293788
ARM 10 531..571
Arm 583..622 CDD:425727
armadillo repeat 587..621 CDD:293788
ARM 11 594..636
armadillo repeat 629..662 CDD:293788
ARM 12 637..666
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..781
Interaction with SCRIB. /evidence=ECO:0000250 772..781
CG12016NP_647805.1 NRK1 6..255 CDD:238982 26/127 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.