DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2-Ke6 and CG12171

DIOPT Version :9

Sequence 1:NP_038571.2 Gene:H2-Ke6 / 14979 MGIID:95911 Length:259 Species:Mus musculus
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:259 Identity:80/259 - (30%)
Similarity:122/259 - (47%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 RSALALVTGAGSGIGRAISVRLAAEGA--AVAACDLD--GAAAQDTVRLLGSPGSEDGAPRGKHA 68
            :..:.:||||.||||...||.||..|.  .:...:||  ...|:..|...|:|..:..|.....:
  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69

Mouse    69 AFQADVSQGPAARRLLEEVQACFSRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVT 133
            ..|..||...|....::           |:|:.|||.....:.:.|.|.:|||:..|::..:.:|
  Fly    70 DVQGIVSATLAKHGRID-----------VLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLT 123

Mouse   134 QAAAQALVSSGGRGSIINISSIIGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPG 198
            ......|:.:  :|:|:|:||:.|.....|...|..|||.|...|:..|.||...|:|.|||.||
  Fly   124 HLVTPELIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPG 186

Mouse   199 FIATP------MTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGG 256
            .|.|.      :.|:...|..:.......||..|:.::||..:|||||:::.:.||.|:.|.||
  Fly   187 VIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2-Ke6NP_038571.2 NADB_Rossmann 11..258 CDD:304358 80/256 (31%)
fabG 12..259 CDD:235546 80/255 (31%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/259 (31%)
NADB_Rossmann 4..254 CDD:304358 80/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.