DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gzme and CG18420

DIOPT Version :9

Sequence 1:NP_034503.2 Gene:Gzme / 14942 MGIID:109265 Length:248 Species:Mus musculus
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:118/279 - (42%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MPPVLILLTLLLPLGAG---------------AEEIIGGHVVKPHSRPYMAFVKSVDIEGNRRYC 50
            |..:|:|||:...||:.               ...|:.|.|...:|.|:|||:.:   ..|:..|
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHT---SSNQFIC 69

Mouse    51 GGFLVQDDFVLTAAHC--RNRTMTVTLGAHNIKAK---EETQQIIPVAKAIPHPDYNATAFFSDI 110
            ||.|:....|||||||  .|.|:.|.||.:|.|.|   ||.|    |.:...|..|:.....:||
  Fly    70 GGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQ----VNRTFQHRFYDPNTHANDI 130

Mouse   111 MLLKLESKAKRTKAVRPL--------KLPRPNARVKPGDVCSVAGWG-SRSINDTKASARLREAQ 166
            .||:|.|.......:||:        |....:.:|..|     .||| :.|::|   |:.||...
  Fly   131 ALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTG-----TGWGRTESMHD---SSELRTLD 187

Mouse   167 LVIQEDEECKKRFRHYTETTEICAGDLKKIKTPFKGDSGGP---LVCDNKAYGL----LAYAKNR 224
            :..|..:.|  .|.... :.:.|||:..  .....||:|||   :|....|:..    :|....|
  Fly   188 ISRQPSKMC--AFGSVL-SNQFCAGNWN--SNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR 247

Mouse   225 TISSGVFTKIVHFLPWISR 243
            .....|||.::..:.:|.|
  Fly   248 CQRPSVFTDVMSHIEFIRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GzmeNP_034503.2 Tryp_SPc 20..241 CDD:214473 71/241 (29%)
Tryp_SPc 21..244 CDD:238113 73/244 (30%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 71/241 (29%)
Tryp_SPc 43..267 CDD:238113 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.