DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gzmd and CG10041

DIOPT Version :9

Sequence 1:NP_034502.2 Gene:Gzmd / 14941 MGIID:109255 Length:252 Species:Mus musculus
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:230 Identity:60/230 - (26%)
Similarity:119/230 - (51%) Gaps:22/230 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 RPYMAFVMSV--DIKG-NRIYCGGFLIQDDFVLTAAHCKNSSVQSSMTVTLGAHNITAKEETQQI 93
            ||...:::|:  ::|| .:..|.|.::.::|||:||||..::....:.|..||.::.::::|:..
  Fly    47 RPRYPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRFF 111

Mouse    94 IPVAKDIPHPDYNATIFYSDIMLLKLESKAK----RTKAVRPLKLPRSNARVKPGDVCSVAGWGS 154
              |.:...||.:. .:..:||.:|::..|..    |.:::.....|:.::    |...|:.|||.
  Fly   112 --VVERRWHPQFR-VLGGNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDS----GTQASLVGWGR 169

Mouse   155 RSINDTKASARLREVQLVIQEDEECKKRFRY-YTETTEICAGDLKKIKTPFKGDSGGPL--VCDN 216
            ..:...:   :|:|:..:..|::||::..|: :.:..:|||..||..:.|..||||.||  |...
  Fly   170 VGVGKIR---KLQEMPFLTMENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKE 231

Mouse   217 QAYGLFAYAKNG--TISSGIFTKVVHFLPWISWNM 249
            :.|||.:|.:..  .:....||::..:..||..:|
  Fly   232 KLYGLLSYGRKACTPLKPYAFTRINAYSSWIQESM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GzmdNP_034502.2 Tryp_SPc 20..245 CDD:214473 57/224 (25%)
Tryp_SPc 21..248 CDD:238113 59/227 (26%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 57/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.