DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gzmd and CG18420

DIOPT Version :9

Sequence 1:NP_034502.2 Gene:Gzmd / 14941 MGIID:109255 Length:252 Species:Mus musculus
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:121/282 - (42%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MPPILILLTL--LL--------------PLRAGAEEIIGGHVVKPHSRPYMAFVMSVDIKGNRIY 49
            |..||:|||:  ||              ||:.| ..|:.|.|...:|.|:|||:.:   ..|:..
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLG-PRIVNGKVAVRNSSPWMAFLHT---SSNQFI 68

Mouse    50 CGGFLIQDDFVLTAAHC--KNSSVQSSMTVTLGAHNITAK---EETQQIIPVAKDIPHPDYNATI 109
            |||.||....|||||||  .|:::    .|.||.:|...|   ||.|    |.:...|..|:...
  Fly    69 CGGTLISRRLVLTAAHCFIPNTTI----VVRLGEYNRKLKGYREEHQ----VNRTFQHRFYDPNT 125

Mouse   110 FYSDIMLLKLESKAKRTKAVRPL--------KLPRSNARVKPGDVCSVAGWG-SRSINDTKASAR 165
            ..:||.||:|.|.......:||:        |....:.:|..|     .||| :.|::|   |:.
  Fly   126 HANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTG-----TGWGRTESMHD---SSE 182

Mouse   166 LREVQLVIQEDEECKKRFRYYTETTEICAGDLKKIKTPFKGDSGGPLVCDNQAYGLFAYAKNGTI 230
            ||.:.:..|..:.|  .|.... :.:.|||:..  .....||:|||:....:....|.:.:.|..
  Fly   183 LRTLDISRQPSKMC--AFGSVL-SNQFCAGNWN--SNLCIGDTGGPVGAMVRYRNAFRFVQVGIA 242

Mouse   231 SS-------GIFTKVVHFLPWI 245
            .:       .:||.|:..:.:|
  Fly   243 ITNKRCQRPSVFTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GzmdNP_034502.2 Tryp_SPc 20..245 CDD:214473 68/245 (28%)
Tryp_SPc 21..248 CDD:238113 69/246 (28%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 68/245 (28%)
Tryp_SPc 43..267 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.