DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gzmb and CG10041

DIOPT Version :9

Sequence 1:NP_038570.1 Gene:Gzmb / 14939 MGIID:109267 Length:247 Species:Mus musculus
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:128/266 - (48%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 ASRTKAGEIIGGHEVKPHSRPYMA-------LLSIKDQQP-------------EAICGGFLIRED 57
            |:.:.|.|.:.  :...:|.|.:|       ::|.:.:.|             :.:|.|.::..:
  Fly    14 AAMSAAQETLS--DTPQNSTPLLATTVSTTKVISFRPRYPYIVSIGENLKGYYKHLCVGVILSNE 76

Mouse    58 FVLTAAHC----EGSIINVTLGAHNIKEQEKTQQVIPMVKCIPHPDYNPKTFSNDIMLLKLKSKA 118
            |||:||||    ....:.|..||.::..:::|:..:  |:...||.:. ....|||.:|::..|.
  Fly    77 FVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRFFV--VERRWHPQFR-VLGGNDIAVLRIYPKF 138

Mouse   119 K----RTRAVRPLNLPRRNVNVKPGDVCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKN 179
            .    |.|::.....|:|:    .|....:.||||:. :||. ..|||:.....::.||:...:.
  Fly   139 PLDDVRFRSINFAGKPQRD----SGTQASLVGWGRVG-VGKI-RKLQEMPFLTMENDECQQSHRF 197

Mouse   180 RYNKTNQICAGDPKTKRASFRGDSGGPL--VCKKVAAGIVSYGYKDGSP--PRAFTKVSSFLSWI 240
            .:.|...|||...|..|....||||.||  |.|:...|::|||.|..:|  |.|||:::::.|||
  Fly   198 VFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPLKPYAFTRINAYSSWI 262

Mouse   241 KKTMKS 246
            :::|.|
  Fly   263 QESMDS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GzmbNP_038570.1 Tryp_SPc 20..240 CDD:214473 68/251 (27%)
Tryp_SPc 21..243 CDD:238113 69/253 (27%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.