DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx6-2 and ftz

DIOPT Version :9

Sequence 1:NP_899071.2 Gene:Nkx6-2 / 14912 MGIID:1352738 Length:277 Species:Mus musculus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:132 Identity:39/132 - (29%)
Similarity:62/132 - (46%) Gaps:22/132 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    78 SLPRLNGLAS---SAGVYFGPAAAVARGYPKPLAELP-GRPPIFWPGVVQGSPWRDPRLAGSAQA 138
            |||.|.|:::   |.|.  ..::||::.....:...| |.....|..:       :..||...  
  Fly   198 SLPPLEGISTPPQSPGE--KSSSAVSQEINHRIVTAPNGAGDFNWSHI-------EETLASDC-- 251

Mouse   139 GGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 203
                 ||.|:  :|.|::..|...|||.|...:|:....|..:|.:|.::|.|:|:||||||.|.
  Fly   252 -----KDSKR--TRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKS 309

Mouse   204 RK 205
            :|
  Fly   310 KK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx6-2NP_899071.2 Homeobox 151..205 CDD:395001 21/53 (40%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 12/58 (21%)
Homeobox 257..310 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.