DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsto1 and GstE6

DIOPT Version :9

Sequence 1:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:201 Identity:49/201 - (24%)
Similarity:93/201 - (46%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 QIRVYSMRFCPFAQRTLMVLKAKGIRHEVININL----KNKPEWFFEKNPLGLVPVLENSQGHLV 83
            ::.:|.:...|..:...:.|.|..:.:|.:|:::    :..|| :.||||...||.||: .||.:
  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLED-DGHYI 65

Mouse    84 TESVITCEYLDEAYPEK-KLFPDDPYKKA--RQKMTLES---FSKVPPLIASFVRSKRKEDSPNL 142
            .:|.....||...|.:. .|:|.||.|:|  .|::..||   |:.....|:..|..:.:...|..
  Fly    66 WDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKE 130

Mouse   143 R-EALENEFKKLE---EGMDNYKSFLGGDSPSMVDYLTWPWFQRLEALELKECLAHTPKLKLWMA 203
            | :|:...:..:|   :|.|    ::.|:..::.|:........|||....:...: |::..|:.
  Fly   131 RYDAIIEIYDFVETFLKGQD----YIAGNQLTIADFSLVSSVASLEAFVALDTTKY-PRIGAWIK 190

Mouse   204 AMQQDP 209
            .::|.|
  Fly   191 KLEQLP 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 20/74 (27%)
GstA 26..224 CDD:223698 49/198 (25%)