DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsto1 and GstE9

DIOPT Version :9

Sequence 1:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:203 Identity:55/203 - (27%)
Similarity:89/203 - (43%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 GQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININL---KNKPEWFFEKNPLGLVPVLENSQGHLV 83
            |::.:|.:...|..:...:.|.|.|:::|...:||   ::|.:.|..|||...|||||: .|..:
  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLED-DGKFI 65

Mouse    84 TESVITCEYLDEAYPEK-KLFPDDPYKKA--RQKMTLES---FSKVPPLIASFVRSKRKEDSPNL 142
            .||...|.||...|.:. .|:|.|.:|:|  .|::..||   |......||..:..|      |:
  Fly    66 WESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYK------NI 124

Mouse   143 REALENEFKKLEEGMDNYKSFLG------GDSPSMVDYLTWPWFQRLEALELKECLAHTPKLKLW 201
            .|...::...:.|..|..::|:|      |...::.||........|..|...:...: |||..|
  Fly   125 TEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY-PKLNGW 188

Mouse   202 MAAMQQDP 209
            :..|...|
  Fly   189 LDRMAAQP 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 24/74 (32%)
GstA 26..224 CDD:223698 54/199 (27%)