DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstD8

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:209 Identity:49/209 - (23%)
Similarity:94/209 - (44%) Gaps:28/209 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTES 67
            ::.|....|.|.|:|.:.||..|:....:.:.::.|:.:..:|.::|..:.:|.|.|..|.:.| 
  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWE- 64

Mouse    68 PSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGV 132
                  |.||||||..||...|..||:|.|.:|.|::.|.:....:..:|              |
  Fly    65 ------SRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSF--------------V 109

Mouse   133 QVPQEKVERNRDRMVLVLQQLE------DKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLF 191
            :....::..|.......:|:::      |.||.|:.::.|..:|:||:..|..:.....:.:::.
  Fly   110 EAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIA 174

Mouse   192 EGRPQLTAWRERVE 205
            : .|.:..|.|..:
  Fly   175 Q-YPNVARWYENAK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 23/81 (28%)
GST_C_Theta 98..223 CDD:198292 19/114 (17%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 49/209 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/79 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/115 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.