DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstD6

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:235 Identity:62/235 - (26%)
Similarity:108/235 - (45%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYLDLLSQPS-RAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTE 66
            ::|| ::...|| |||.:.||..|:.|.:..|:...|:.:...|.::|..:.:|.|.|..||:.|
  Fly     1 MDLY-NMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWE 64

Mouse    67 SPSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYL----GWHADNIRGTFGVLLWTKVLG 127
                   :.||::||..:|...|..||.|.|.:|.:::.|    |...|.|...|..||.|    
  Fly    65 -------TRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRT---- 118

Mouse   128 PLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFE 192
               |....||.:|:......|:     :.||..:.::.|.|:::||::.|..:.....:.::| :
  Fly   119 ---GKPGTQENLEKLNAAFDLL-----NNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDL-K 174

Mouse   193 GRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKML 232
            ..|.:..|      :..|:.........|:.: |:|||.|
  Fly   175 KFPNVDRW------YKNAQKVTPGWDENLARI-QSAKKFL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 25/82 (30%)
GST_C_Theta 98..223 CDD:198292 26/128 (20%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 25/80 (31%)
PLN02395 11..208 CDD:166036 59/224 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.