DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstD3

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:184 Identity:46/184 - (25%)
Similarity:85/184 - (46%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 KKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPSSMIPSTAILIYLSSKYQ 86
            |..|:.|..:.::.|||:.|:..|.::|..:.:|.|.|..|.:.|       |.|||:||..||.
  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWE-------SRAILVYLVEKYG 61

Mouse    87 VADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQ 151
            ..|..||.|:|.:|.:::.|.:....:..|.....:........|.:...:||:...|.:     
  Fly    62 KDDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFL----- 121

Mouse   152 QLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGRPQLTAWRERVE 205
               :.||..:.::.|.|.|:||:..|..:.....:|:::.: .|.:..|.:.|:
  Fly   122 ---NTFLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 20/62 (32%)
GST_C_Theta 98..223 CDD:198292 19/108 (18%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 20/60 (33%)
GstA 6..173 CDD:223698 45/182 (25%)
GST_C_Delta_Epsilon 72..188 CDD:198287 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844532
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.