DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and eEF1gamma

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:226 Identity:60/226 - (26%)
Similarity:101/226 - (44%) Gaps:64/226 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 IFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPSSMIPS--TAILIYL 81
            |.|:.:|.  |.:..|..|       |.:.|        |...| |.:.|...:|:  ||...||
  Fly    20 IAAQYSGA--QVKVADNFK-------FGETN--------KSAEF-LKKFPGGKVPAFETAEGQYL 66

Mouse    82 SSKYQVADHWYPADLQAR--------AQVHEYLGWHADN--IRGTFGVLLWTKVLGPLIGVQVPQ 136
            |....:|  :..|:.|.|        |||.:::.: |||  :..:   ..|   :.||:|: :||
  Fly    67 SESNAIA--YLLANEQLRGGKCPFVQAQVQQWISF-ADNEIVPAS---CAW---VFPLLGI-LPQ 121

Mouse   137 EKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEG--RPQLTA 199
            :|....:.....|||||..| |:|..||.|:::||||::....|:       :|:|.  .|.:.:
  Fly   122 QKNSTAKQEAEAVLQQLNQK-LQDATFLAGERITLADIVVFSSLL-------HLYEYVLEPSVRS 178

Mouse   200 -------W------RERVEAFL-GAELCQEA 216
                   |      :::|:|.: ..:||::|
  Fly   179 AFGNVNRWFVTILNQKQVQAVVKDYKLCEKA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 18/67 (27%)
GST_C_Theta 98..223 CDD:198292 39/145 (27%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 20/78 (26%)
GstA 5..187 CDD:223698 54/202 (27%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 37/134 (28%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.