Sequence 1: | XP_011241675.1 | Gene: | Gstt2 / 14872 | MGIID: | 106188 | Length: | 251 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189308.1 | Gene: | eEF1gamma / 44791 | FlyBaseID: | FBgn0029176 | Length: | 431 | Species: | Drosophila melanogaster |
Alignment Length: | 226 | Identity: | 60/226 - (26%) |
---|---|---|---|
Similarity: | 101/226 - (44%) | Gaps: | 64/226 - (28%) |
- Green bases have known domain annotations that are detailed below.
Mouse 19 IFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPSSMIPS--TAILIYL 81
Mouse 82 SSKYQVADHWYPADLQAR--------AQVHEYLGWHADN--IRGTFGVLLWTKVLGPLIGVQVPQ 136
Mouse 137 EKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEG--RPQLTA 199
Mouse 200 -------W------RERVEAFL-GAELCQEA 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gstt2 | XP_011241675.1 | GST_N_Theta | 3..85 | CDD:239348 | 18/67 (27%) |
GST_C_Theta | 98..223 | CDD:198292 | 39/145 (27%) | ||
eEF1gamma | NP_001189308.1 | GST_N_EF1Bgamma | 4..79 | CDD:239342 | 20/78 (26%) |
GstA | 5..187 | CDD:223698 | 54/202 (27%) | ||
GST_C_EF1Bgamma_like | 90..209 | CDD:198290 | 37/134 (28%) | ||
EF1G | 271..376 | CDD:279041 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |