DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstD11

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:221 Identity:62/221 - (28%)
Similarity:99/221 - (44%) Gaps:20/221 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 SQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPSSMIPST 75
            |.|.|::.:.||...|.|:.:.|:||:|:.:...|..:|..:.||.:.|...||.|       |.
  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWE-------SR 90

Mouse    76 AILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVE 140
            |||.||.:.|..:|..||.|::.||.|.:.|.:..    ||..:.| |....|.:.:..|.:  |
  Fly    91 AILSYLVA
AYGKSDQLYPTDIRVRALVDQRLQFDL----GTLYMRL-TDYYFPTMFIGAPLD--E 148

Mouse   141 RNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGRP--QLTAWRER 203
            ..|.::...:..| :..|..|.|......|:|||..|..:.|..|..   ||.||  .:..|.:|
  Fly   149 GKRAKLAEAVGWL-NTILEGRQFSAADHFTIADLTLLVTVSQLEAFE---FELRPYKHIRQWLDR 209

Mouse   204 VEAFLGAELCQEAHSTILSILGQAAK 229
            .:..:.....:|.::...::|....|
  Fly   210 CKDHMAPFDYEELNANKANMLADMFK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 25/73 (34%)
GST_C_Theta 98..223 CDD:198292 30/126 (24%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 25/71 (35%)
GST_C_Delta_Epsilon 112..231 CDD:198287 30/129 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.