DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstE7

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:216 Identity:61/216 - (28%)
Similarity:97/216 - (44%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 GLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTE 66
            |||     .|.|.|||.:......:|::...|:....::.||:|.:.|..:.||.|:|....:.:
  Fly     8 GLE-----ASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67

Mouse    67 SPSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLL---WTKVLGP 128
                   |.||:.||.|||...|..||.||..||.|.:.|.:.:       ||:.   ...:..|
  Fly    68 -------SHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFES-------GVIFANALRSITKP 118

Mouse   129 LIG---VQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLAD------LMSLEELMQPV 184
            |..   ..:|:|:.    |.::.|...|| |||....::.|.|:|:||      :.|||..::..
  Fly   119 LFAGKQTMIPKERY----DAIIEVYDFLE-KFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVD 178

Mouse   185 ALGYNLFEGRPQLTAWRERVE 205
            ...|      |::.||.:|::
  Fly   179 TTKY------PRIAAWFKRLQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 23/81 (28%)
GST_C_Theta 98..223 CDD:198292 30/120 (25%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 61/216 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/80 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.