DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstE6

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:212 Identity:59/212 - (27%)
Similarity:98/212 - (46%) Gaps:31/212 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELY-LDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTE 66
            |.|| || .|.|.|||.:......:.::...|||:....:|.::.:.|..:.||.|:|....:.:
  Fly     4 LTLYGLD-PSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67

Mouse    67 SPSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWH-----ADNIRGTFGVLLWTKVL 126
                   |.||:.||.|||..:|..||.|...||.|.:.|.:.     |:.||.....:|:.   
  Fly    68 -------SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ--- 122

Mouse   127 GPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLAD---LMSLEELMQPVALGY 188
                    .|.||.:.|...::.:....:.||:.:.::.|.|:|:||   :.|:..|...|||..
  Fly   123 --------GQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDT 179

Mouse   189 NLFEGRPQLTAWRERVE 205
            ..:   |::.||.:::|
  Fly   180 TKY---PRIGAWIKKLE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 25/82 (30%)
GST_C_Theta 98..223 CDD:198292 28/116 (24%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/212 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/80 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844543
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.