DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstE2

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:213 Identity:66/213 - (30%)
Similarity:101/213 - (47%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTES 67
            |.||...:|.|.||..:..:...:.::.:.:|:|.|.|..:.|.:.|..:.||:|:|...::.: 
  Fly     5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD- 68

Mouse    68 PSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWT--KVLGPLI 130
                  |.||:.||..||..:|..||.||..||||.:.|.:.|       .:|..:  .|..|..
  Fly    69 ------SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDA-------SILFMSLRNVSIPYF 120

Mouse   131 GVQ---VPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADL------MSLEELMQPVAL 186
            ..|   ||:|||:..:|    ....||: ||.|..:|.|.|:|:|||      .||..::....|
  Fly   121 LRQVSLVPKEKVDNIKD----AYGHLEN-FLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDEL 180

Mouse   187 GYNLFEGRPQLTAWRERV 204
            .|      |::.||.||:
  Fly   181 KY------PKVAAWFERL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 22/81 (27%)
GST_C_Theta 98..223 CDD:198292 37/118 (31%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 66/213 (31%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/79 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 37/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844538
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.