DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstE13

DIOPT Version :9

Sequence 1:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:243 Identity:70/243 - (28%)
Similarity:114/243 - (46%) Gaps:41/243 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 LYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPS 69
            ||..|.|.|:||..:.||..|:..:.:.||..|.:|:||:|.::|..:::||..|      ....
  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVD------SDGE 64

Mouse    70 SMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQV 134
            ..:.|.||:.:|.:||...|..||.||:.||.:...:  |.:|     |||.  :|:..::...:
  Fly    65 VYVDSHAIVCFLVA
KYAGNDQLYPRDLKRRAHIDHRM--HYEN-----GVLF--QVVKDIVARNI 120

Mouse   135 PQEKVERNRDRMVLVLQQLED--KFLRDRAFLVGQQVTLAD------LMSLEELMQPVALGYNLF 191
            ...:.|.|...:.|......|  .||:..:|:||.::::||      |::| :|:.||..     
  Fly   121 YGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTL-DLLIPVER----- 179

Mouse   192 EGRPQLTAWRERVEAFL---------GAELCQEAHSTILSILGQAAKK 230
            |..||...|.||::..|         ||...|   :.|||.:.:...|
  Fly   180 EKYPQTKQWMERMDKLLPDNEEINLKGARALQ---TRILSCMAENKAK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 25/79 (32%)
GST_C_Theta 98..223 CDD:198292 36/141 (26%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 25/77 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.