DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD7

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:174 Identity:51/174 - (29%)
Similarity:83/174 - (47%) Gaps:18/174 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67
            |:||...::...|||.:.||...:......:...:|:.|...|.|:||...:|.::|.||.:.||
  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68

Mouse    68 VAILLYLAHKYKVPDH-WYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVF----LGEQ 127
            .||.:||..||..||. .||.|.|.||.:::.|.:. .|.....|.    |..|.:|    .|:|
  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFD-MGTLYDALT----KYFFLIFRTGKFGDQ 128

Mouse   128 IPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAI 171
            ...:.:.:....|:.        ||:.:||:.|..:::||:|.:
  Fly   129 EALDKVNSAFGFLNT--------FLEGQDFVAGSQLTVADIVIL 164

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 51/174 (29%)
GST_N_Theta 3..78 CDD:239348 24/74 (32%)