DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD6

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:209 Identity:55/209 - (26%)
Similarity:94/209 - (44%) Gaps:34/209 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67
            ::||....|...||:.:.||...:.|....|....||.|...|.::||...:|.::|..|.:.|:
  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65

Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQ----HTGLRRSCLRALWHKVMFPVF-LGEQ 127
            .||::||..:|...|..||:|.|.:|.:::.|.:.    :.|:.         |..||:. .|:.
  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIA---------KYFFPLLRTGKP 121

Mouse   128 IPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAI-----TELMHPVGGGCPVFE- 186
            ...|.|....|..|     |.:.||..:|::.|..:|:||:|.:     ||::.        |: 
  Fly   122 GTQENLEKLNAAFD-----LLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVD--------FDL 173

Mouse   187 -GHPRLAAWYQRVE 199
             ..|.:..||:..:
  Fly   174 KKFPNVDRWYKNAQ 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 55/209 (26%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)