DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD5

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:204 Identity:47/204 - (23%)
Similarity:93/204 - (45%) Gaps:32/204 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67
            ::.|.......||.:.:.||...:...|..:...:.:.|...|.::||...:|.::|.||::.||
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVF----LGEQI 128
            .||.:||..||...|..:|:|.:.:|.|::.|.:....|..|     :.|..:|:|    .|...
  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDS-----FAKYYYPLFHTGKPGSDE 125

Mouse   129 PPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVFE------- 186
            ..:.:.::...|::        ||:.::::.|.|:::||:..::.:        ..||       
  Fly   126 DFKKIESSFEYLNI--------FLEGQNYVAGDHLTVADIAILSTV--------STFEIFDFDLN 174

Mouse   187 GHPRLAAWY 195
            .:|.:|.||
  Fly   175 KYPNVARWY 183

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 47/204 (23%)
GST_N_Theta 3..78 CDD:239348 20/74 (27%)