DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD3

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:178 Identity:47/178 - (26%)
Similarity:86/178 - (48%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 KKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVAILLYLAHKYKVPDHWYP 86
            |...:.|....:...|||.::..|.::||...:|.::|.|||:.||.|||:||..||...|..||
  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68

Mouse    87 QDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPETLAATLAELDVNLQVLEDKF 151
            :|:|.:|.:::.|.:. ..|....|...::|.......|.:...:.:..|...|:.        |
  Fly    69 KDIQKQAVINQRLYFD-MALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNT--------F 124

Mouse   152 LQDKDFLVGPHISLADLVAITELMHPVGGGCPVFEGHPRLAAWYQRVE 199
            |:.:|::.|...::||:..:..:.:....|..:.: :|.:|.||..|:
  Fly   125 LEGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVK 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 47/178 (26%)
GST_N_Theta 3..78 CDD:239348 20/55 (36%)