DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD11

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:171 Identity:59/171 - (34%)
Similarity:85/171 - (49%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 SQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVAILLYLA 75
            |.|||:|.:.||..:|.|::..|.:.:||.|...|..:||...||.|.|.|..|.||.|||.||.
  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97

Mouse    76 HKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKV---MFP-VFLGEQIPPETLAAT 136
            ..|...|..||.|::.||.||:.|.:.        |..|:.::   .|| :|:|..: .|...|.
  Fly    98 AAYGKSDQLYPTDIRVRALVDQRLQFD--------LGTLYMRLTDYYFPTMFIGAPL-DEGKRAK 153

Mouse   137 LAELDVNLQVLEDKFLQDKDFLVGPHISLAD---LVAITEL 174
            |||....|..:    |:.:.|....|.::||   ||.:::|
  Fly   154 LAEAVGWLNTI----LEGRQFSAADHFTIADLTLLVTVSQL 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 59/171 (35%)
GST_N_Theta 3..78 CDD:239348 29/66 (44%)