DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstD9

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:214 Identity:59/214 - (27%)
Similarity:95/214 - (44%) Gaps:34/214 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 VLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCE 66
            :|:.|..|.|.|||:|.:.|:...:......|:|..||||...|.::||...:|.::|.||.:.|
  Fly     1 MLDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE 65

Mouse    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPE 131
            |.|||:|||.||......||:|.|.||.:::.|.:..:.|.:|     :....:|....:...| 
  Fly    66 SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQS-----YVYYYYPQLFEDVKKP- 124

Mouse   132 TLAATLAELDVNLQVLEDKFLQDKDFLVGPH------ISLADLVAITELMHPVGGGCPVFE---- 186
                  |:.| ||:.::|.|......|.|..      ::|||...:..:        ..||    
  Fly   125 ------ADPD-NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATV--------STFEISEY 174

Mouse   187 ---GHPRLAAWYQRVEAAV 202
               .:|.:..||...:..:
  Fly   175 DFGKYPEVVRWYDNAKKVI 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 59/213 (28%)
GST_N_Theta 3..78 CDD:239348 30/74 (41%)