DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE11

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:213 Identity:61/213 - (28%)
Similarity:95/213 - (44%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 LYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVA 69
            ||....|.||||:.:.|....:...:..|.::.|||.|..|.::|....:|.:.|.|..:.:|..
  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71

Mouse    70 ILLYLAHKY--KVPDHWYPQDLQARARVDEYLAWQ--HTGLRRSCLRALWHKVMF---PV--FLG 125
            |..|||.||  :..|..||:|.:.|..||..|.:.  |          |:.::.|   ||  |..
  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGH----------LFPRIRFIVEPVIYFGA 126

Mouse   126 EQIPPETLAATLAELDVNLQVLEDKF---LQDKDFLVGPHISLADL-----VAITELMHPVGGGC 182
            .::|.:.:|        .||...|..   |.:.|:|||..:::|||     |:..|...|:..  
  Fly   127 GEVPSDRVA--------YLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEP-- 181

Mouse   183 PVFEGHPRLAAWYQRVEA 200
               :..|||..|.:|::|
  Fly   182 ---DQFPRLVQWVKRIQA 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 61/213 (29%)
GST_N_Theta 3..78 CDD:239348 23/72 (32%)