DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE7

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:196 Identity:60/196 - (30%)
Similarity:97/196 - (49%) Gaps:21/196 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 SQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVAILLYLA 75
            |.|.||:.:......:|::...|..|..|:.|:.|.:.||...||.:.|.|..:.:|.||:.||.
  Fly    12 SPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76

Mouse    76 HKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQ--IPPETLAATLA 138
            .||...|..||:||..||.||:.|.::...:..:.||:    :..|:|.|:|  ||.|...|.:.
  Fly    77 SKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRS----ITKPLFAGKQTMIPKERYDAIIE 137

Mouse   139 ELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVF-----EGHPRLAAWYQRV 198
            ..|     ..:|||...|::.|..:::||...|:.:     ....||     ..:||:|||::|:
  Fly   138 VYD-----FLEKFLAGNDYVAGNQLTIADFSIISTV-----SSLEVFVKVDTTKYPRIAAWFKRL 192

Mouse   199 E 199
            :
  Fly   193 Q 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 60/196 (31%)
GST_N_Theta 3..78 CDD:239348 21/66 (32%)