DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE6

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:204 Identity:55/204 - (26%)
Similarity:97/204 - (47%) Gaps:21/204 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELY-LDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCE 66
            |.|| || .|.|.||:.:.....|:.::...|::.....||..:...||...||.:.|.|..:.:
  Fly     4 LTLYGLD-PSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67

Mouse    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGE-QIPP 130
            |.||:.||..||...|..||:|...||.||:.|.::...:..:.:|::...|:|.   |: ::|.
  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ---GQTKVPK 129

Mouse   131 ETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVFEG-----HPR 190
            |...|.:...|     ..:.||:.:|::.|..:::||...::.:     .....|..     :||
  Fly   130 ERYDAIIEIYD-----FVETFLKGQDYIAGNQLTIADFSLVSSV-----ASLEAFVALDTTKYPR 184

Mouse   191 LAAWYQRVE 199
            :.||.:::|
  Fly   185 IGAWIKKLE 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 55/204 (27%)
GST_N_Theta 3..78 CDD:239348 24/75 (32%)