DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstE3

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:215 Identity:66/215 - (30%)
Similarity:104/215 - (48%) Gaps:39/215 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 SQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVAILLYLA 75
            |.|.|::.:..:..|:.|....|.|.:.|||...|.::||:..|||:.|.||.|.:|.||..||.
  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76

Mouse    76 HKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGE--QIPP---ETLAA 135
            .||...|..||:||:.||.||:.|.:.     .|.:.:....:.||:|...  :||.   :.|..
  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYD-----SSVVTSTGRAITFPLFWENKTEIPQARIDALEG 136

Mouse   136 TLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGG--GCPVF-----EGHPRLAA 193
            ....|::        ||::.::|.|.::::||       .|.:.|  |..||     ..:|.|||
  Fly   137 VYKSLNL--------FLENGNYLAGDNLTIAD-------FHVIAGLTGFFVFLPVDATKYPELAA 186

Mouse   194 WYQRVEAAVGKDL--FREAH 211
            |.:|:     |:|  :.||:
  Fly   187 WIKRI-----KELPYYEEAN 201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 66/215 (31%)
GST_N_Theta 3..78 CDD:239348 25/66 (38%)