DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt1 and GstT2

DIOPT Version :9

Sequence 1:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:209 Identity:70/209 - (33%)
Similarity:120/209 - (57%) Gaps:19/209 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67
            :..|.||||...|.::|..|.:|.|.:...:.|||.|.|:|.:.::|..::|||::.|.|.|.|:
  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69

Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSC---LRALWHKVMFPV-FLGEQI 128
            :||:.|||.|.:..:..||:.|:.||||||:|.|||..:|.:|   .|..|   :||: .:..:.
  Fly    70 IAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAW---LFPMNGIAPKP 131

Mouse   129 PPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITEL------MHPVGGGCPVFEG 187
            .||.:.|.:..::.||.:||..:|:: |||||.::::||::..:|:      .:.|..     :.
  Fly   132 KPEQIQALIEGVENNLGLLERLWLEN-DFLVGKNLTMADILGSSEINQLRLCQYRVDE-----KK 190

Mouse   188 HPRLAAWYQRVEAA 201
            .|::..|.:||..:
  Fly   191 FPKVVKWLERVRVS 204

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt1NP_032211.3 GstA 3..212 CDD:223698 70/209 (33%)
GST_N_Theta 3..78 CDD:239348 29/74 (39%)