DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstm4 and GstT2

DIOPT Version :9

Sequence 1:NP_081040.1 Gene:Gstm4 / 14865 MGIID:95862 Length:218 Species:Mus musculus
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:210 Identity:50/210 - (23%)
Similarity:95/210 - (45%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 YWDIRG-LAHAIRLLLEYTGSSYEEKRYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKI 70
            |:|:.. :|..:.:.|:::.|..|.....:      .:.:.|::::|....|..:|.::.|...:
  Fly     8 YYDLLSPIARGLWIGLKFSNSPVEYCPIAL------RKFEQLTDEYKKINRFQKVPAIVGGDFHL 66

Mouse    71 TQSNAILRYIARK----HNLCGETEEEKIRVD-ILENQAMDVSNQLARVCYSPDFEKLKVEYL-- 128
            :::.||:||:|.|    ..|..:|.|.:.||| .||.|.:::  :||...|..|.....:..:  
  Fly    67 SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNI--RLACSMYFRDAWLFPMNGIAP 129

Mouse   129 ----EQLPGMVKLFSQFLG--QRTW-----FVGEKITFVDFL-AYDILDLHLIFEPTCLDAFPNL 181
                ||:..:::.....||  :|.|     .||:.:|..|.| :.:|..|.|.........||.:
  Fly   130 KPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKV 194

Mouse   182 KDFVARFEVLKRISA 196
            ..::.|.    |:||
  Fly   195 VKWLERV----RVSA 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstm4NP_081040.1 GST_N_Mu 3..84 CDD:239373 17/81 (21%)