DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstm2 and GstT2

DIOPT Version :9

Sequence 1:NP_032209.1 Gene:Gstm2 / 14863 MGIID:95861 Length:218 Species:Mus musculus
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:239 Identity:59/239 - (24%)
Similarity:103/239 - (43%) Gaps:67/239 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 YWDIRG-LAHAIRLLLEYTDTSYED-----KKYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLID 65
            |:|:.. :|..:.:.|:::::..|.     :|:           :.|::::|....|..:|.::.
  Fly     8 YYDLLSPIARGLWIGLKFSNSPVEYCPIALRKF-----------EQLTDEYKKINRFQKVPAIVG 61

Mouse    66 GSHKITQSNAILRYLARK----HNLCGETEEERIRVD-ILENQAMDTRIQLAMVCYSPD------ 119
            |...::::.||:||||.|    ..|..:|.|.|.||| .||.|.::.|:..:|  |..|      
  Fly    62 GDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSM--YFRDAWLFPM 124

Mouse   120 ---FEKKKPEYLE----------GLPEKMKLYSEFLGKQPWFAGNKVTYVDFLVYDVLD-----Q 166
               ..|.|||.::          ||.|::.|.::||      .|..:|..|.|....::     |
  Fly   125 NGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFL------VGKNLTMADILGSSEINQLRLCQ 183

Mouse   167 HRIFEPKCLDAFPNLKDFMGRF---------EGLKKISDYMKSS 201
            :|:.|.|    ||.:..::.|.         |||..|....|.|
  Fly   184 YRVDEKK----FPKVVKWLERVRVSANPYHDEGLTFIDRKSKQS 223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstm2NP_032209.1 PTZ00057 3..202 CDD:173353 59/239 (25%)
GST_N_Mu 3..84 CDD:239373 18/86 (21%)