DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsx2 and ftz

DIOPT Version :9

Sequence 1:NP_573555.1 Gene:Gsx2 / 14843 MGIID:95843 Length:305 Species:Mus musculus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:121 Identity:49/121 - (40%)
Similarity:66/121 - (54%) Gaps:17/121 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   141 PQQPGSAAAAAAAAAAAAAAAAALGHPQHHAPVCAATTYNMSDPRRFHCLSMGGSDTSQVPNGKR 205
            ||.||.        .:::|.:..:.|....|| ..|..:|.|     |......||..   :.||
  Fly   209 PQSPGE--------KSSSAVSQEINHRIVTAP-NGAGDFNWS-----HIEETLASDCK---DSKR 256

Mouse   206 MRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKE 261
            .|..:|..|.||||:||..|.|::|.|||:||..|:|||:|:||||||||:|.||:
  Fly   257 TRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gsx2NP_573555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..151 4/9 (44%)
Homeobox 207..259 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..305 2/3 (67%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 12/52 (23%)
Homeobox 257..310 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.