Sequence 1: | NP_573555.1 | Gene: | Gsx2 / 14843 | MGIID: | 95843 | Length: | 305 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001368995.1 | Gene: | Scr / 40833 | FlyBaseID: | FBgn0003339 | Length: | 564 | Species: | Drosophila melanogaster |
Alignment Length: | 373 | Identity: | 94/373 - (25%) |
---|---|---|---|
Similarity: | 114/373 - (30%) | Gaps: | 184/373 - (49%) |
- Green bases have known domain annotations that are detailed below.
Mouse 67 SHLHSSRPPAGAGGGATGTAGAAVAGGGVAGGTG----ALPLLKSQFSPAPGDAQFCPRVSHAHH 127
Mouse 128 HHHPPQHHH----------------------------HHHQPQQPGSAAAAAAAAA--------- 155
Mouse 156 ----------------------------------------------------------------- 155
Mouse 156 -------------------------AAAAAAAALGHPQHHAPVCAATTYNMSDPRRFHCLSMGGS 195
Mouse 196 D-------------------------------------TSQV-PNG--KRMRTAFTSTQLLELER 220
Mouse 221 EFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGASRN 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gsx2 | NP_573555.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 115..151 | 10/63 (16%) | |
Homeobox | 207..259 | CDD:278475 | 33/51 (65%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 259..305 | 7/10 (70%) | |||
Scr | NP_001368995.1 | Homeobox | 328..381 | CDD:395001 | 33/52 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |