DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsx1 and Antp

DIOPT Version :9

Sequence 1:NP_032204.1 Gene:Gsx1 / 14842 MGIID:95842 Length:261 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:234 Identity:72/234 - (30%)
Similarity:89/234 - (38%) Gaps:77/234 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 PEGSPPPL--------------FPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPP 71
            |||..|||              .|:.:..|.|..|.:       ..|:    |......|.|...
  Fly   175 PEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYT-------DVGV----PDVTEVHQNHHNM 228

Mouse    72 G--------PPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQTSYPLPDP 128
            |        ||      ...||.|..:......:.|...|| .|.|              |..:|
  Fly   229 GMYQQQSGVPP------VGAPPQGMMHQGQGPPQMHQGHPG-QHTP--------------PSQNP 272

Mouse   129 RQFHCISVDSSSNQLPS---------------SKRMRTAFTSTQLLELEREFASNMYLSRLRRIE 178
                    :|.|:.:||               .||.|..:|..|.||||:||..|.||:|.||||
  Fly   273 --------NSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIE 329

Mouse   179 IATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAG 217
            ||..|.|:|:|:||||||||:|.|||.|.....|..|.|
  Fly   330 IAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gsx1NP_032204.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeobox 150..203 CDD:395001 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..261 7/17 (41%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 34/170 (20%)
Homeobox 301..354 CDD:395001 32/52 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.