Sequence 1: | NP_032204.1 | Gene: | Gsx1 / 14842 | MGIID: | 95842 | Length: | 261 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477498.1 | Gene: | ftz / 40834 | FlyBaseID: | FBgn0001077 | Length: | 410 | Species: | Drosophila melanogaster |
Alignment Length: | 219 | Identity: | 64/219 - (29%) |
---|---|---|---|
Similarity: | 88/219 - (40%) | Gaps: | 71/219 - (32%) |
- Green bases have known domain annotations that are detailed below.
Mouse 18 KKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKAS 82
Mouse 83 FPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSK 147
Mouse 148 RMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRG 212
Mouse 213 GAGAG-------------AGGGAP 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gsx1 | NP_032204.1 | SNAG domain. /evidence=ECO:0000250 | 1..20 | 1/1 (100%) | |
Homeobox | 150..203 | CDD:395001 | 31/52 (60%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 201..261 | 9/36 (25%) | |||
ftz | NP_477498.1 | FTZ | 1..248 | CDD:281812 | 21/121 (17%) |
Homeobox | 257..310 | CDD:278475 | 31/52 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |