DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsx1 and ftz

DIOPT Version :9

Sequence 1:NP_032204.1 Gene:Gsx1 / 14842 MGIID:95842 Length:261 Species:Mus musculus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:219 Identity:64/219 - (29%)
Similarity:88/219 - (40%) Gaps:71/219 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 KKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKAS 82
            |.....:|||..|.::||   |.|:|.                            ||..|..|:|
  Fly   184 KNGDFATPPPTTPTSLPP---LEGIST----------------------------PPQSPGEKSS 217

Mouse    83 FPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSK 147
                            .:||..:.|....|...|..:..|:           ..::.::....||
  Fly   218 ----------------SAVSQEINHRIVTAPNGAGDFNWSH-----------IEETLASDCKDSK 255

Mouse   148 RMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRG 212
            |.|..:|..|.||||:||..|.|::|.|||:||..|:|||:|:||||||||:|.||:....:...
  Fly   256 RTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSPE 320

Mouse   213 GAGAG-------------AGGGAP 223
            ..|||             |..|||
  Fly   321 HCGAGYTAMLPPLEATSTATTGAP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gsx1NP_032204.1 SNAG domain. /evidence=ECO:0000250 1..20 1/1 (100%)
Homeobox 150..203 CDD:395001 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..261 9/36 (25%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 21/121 (17%)
Homeobox 257..310 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.