DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAMD13 and mbtr-1

DIOPT Version :10

Sequence 1:XP_016855866.1 Gene:SAMD13 / 148418 HGNCID:24582 Length:122 Species:Homo sapiens
Sequence 2:NP_001122542.1 Gene:mbtr-1 / 171624 WormBaseID:WBGene00021661 Length:564 Species:Caenorhabditis elegans


Alignment Length:34 Identity:12/34 - (35%)
Similarity:17/34 - (50%) Gaps:5/34 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    85 MTRNDVL-TGLQLKLGPALKIYEYH----VKPLQ 113
            |...|:. .|..||..||:|..:|.    :||:|
 Worm   155 MLSEDIFDIGSGLKQDPAMKWLQYRPLSLLKPMQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAMD13XP_016855866.1 SAM_Atherin-like 48..116 CDD:188982 12/34 (35%)
mbtr-1NP_001122542.1 MBT 96..>164 CDD:459242 2/8 (25%)
MBT 217..326 CDD:214723
MBT_dSfmbt-like_rpt3 369..460 CDD:439089
MBT 479..549 CDD:459242
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.