DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAMD11 and gmeb-3

DIOPT Version :9

Sequence 1:NP_001372569.1 Gene:SAMD11 / 148398 HGNCID:28706 Length:845 Species:Homo sapiens
Sequence 2:NP_497762.2 Gene:gmeb-3 / 175487 WormBaseID:WBGene00008092 Length:376 Species:Caenorhabditis elegans


Alignment Length:196 Identity:47/196 - (23%)
Similarity:77/196 - (39%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    72 AYLSLHEAAPHLHLPRDPLALERFSATAAAAPDFQPLLDNGEPCIEVECGANRALLYVRKL-CQG 135
            :|..|...:.|:..|..||     :||.                :.|.||..:.:::::.. |.|
 Worm    53 SYTYLDTPSEHIWTPIVPL-----NATT----------------VPVTCGYVKGIMHLKLFRCPG 96

Human   136 SKGPSIRHRGEWLTPNEFQFVSGRETAKDWKRSIRHKGKSLKTLMSKGILQV--HPPIC--DCPG 196
            .:...|.:..::|||.:|..:.|:...||||..||.:..||:||:....:..  |..||  .|..
 Worm    97 IRQACIEYESQYLTPKQFTELGGKGRQKDWKACIRVENVSLRTLLENKTIDFYNHKSICHGQCQS 161

Human   197 CRI-----SSPVNRGRLADKRTVALPAARNLKKERTPSFSASDGDSD----GSGPTCGRRPGLKQ 252
            ...     .:|||:..|.|     :.|:.:...|.|...|....:..    |.|...|::...|.
 Worm   162 RNYMNSTGRAPVNKRHLED-----VLASGDDASEPTEQSSGQISEEPIKKRGRGRPAGKKNKAKL 221

Human   253 E 253
            |
 Worm   222 E 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAMD11NP_001372569.1 SAND 113..185 CDD:396076 21/72 (29%)
SAM_Samd7,11 704..771 CDD:188978
gmeb-3NP_497762.2 SAND 74..147 CDD:128554 22/88 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.