Sequence 1: | NP_001372569.1 | Gene: | SAMD11 / 148398 | HGNCID: | 28706 | Length: | 845 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497762.2 | Gene: | gmeb-3 / 175487 | WormBaseID: | WBGene00008092 | Length: | 376 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 40/196 - (20%) |
- Green bases have known domain annotations that are detailed below.
Human 72 AYLSLHEAAPHLHLPRDPLALERFSATAAAAPDFQPLLDNGEPCIEVECGANRALLYVRKL-CQG 135
Human 136 SKGPSIRHRGEWLTPNEFQFVSGRETAKDWKRSIRHKGKSLKTLMSKGILQV--HPPIC--DCPG 196
Human 197 CRI-----SSPVNRGRLADKRTVALPAARNLKKERTPSFSASDGDSD----GSGPTCGRRPGLKQ 252
Human 253 E 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SAMD11 | NP_001372569.1 | SAND | 113..185 | CDD:396076 | 21/72 (29%) |
SAM_Samd7,11 | 704..771 | CDD:188978 | |||
gmeb-3 | NP_497762.2 | SAND | 74..147 | CDD:128554 | 22/88 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4333 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |