DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAMD11 and lin-61

DIOPT Version :9

Sequence 1:NP_001372569.1 Gene:SAMD11 / 148398 HGNCID:28706 Length:845 Species:Homo sapiens
Sequence 2:NP_001122501.1 Gene:lin-61 / 172467 WormBaseID:WBGene00003041 Length:612 Species:Caenorhabditis elegans


Alignment Length:126 Identity:27/126 - (21%)
Similarity:38/126 - (30%) Gaps:46/126 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   461 PLLSPQNAPHVAL----------------GP---------HLRPPFLGVPSALCQTPGYGFLPPA 500
            ||....|..|||.                ||         |:...|: .|....:......:||.
 Worm   439 PLAQQFNNLHVASILKFCKTEGYLIVGMDGPDALEDSFPIHINNTFM-FPVGYAEKYNLELVPPD 502

Human   501 QAE-MFAWQQELLRKQNLARLELPADL----------------LRQKELESARPQLLAPET 544
            :.: .|.| .|.|.|::..  .||.||                ||.:..:....|.:.|.|
 Worm   503 EFKGTFRW-DEYLEKESAE--TLPLDLFKPMPSQERLDKFKVGLRLEAADMCENQFICPAT 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAMD11NP_001372569.1 SAND 113..185 CDD:396076
SAM_Samd7,11 704..771 CDD:188978
lin-61NP_001122501.1 MBT 146..248 CDD:214723
MBT 283..383 CDD:214723
MBT 433..505 CDD:280910 13/66 (20%)
MBT 511..607 CDD:214723 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161457488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.