Sequence 1: | NP_034481.1 | Gene: | Gsc / 14836 | MGIID: | 95841 | Length: | 256 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
Alignment Length: | 257 | Identity: | 69/257 - (26%) |
---|---|---|---|
Similarity: | 106/257 - (41%) | Gaps: | 62/257 - (24%) |
- Green bases have known domain annotations that are detailed below.
Mouse 24 PVAPSAAAPVVFPALHGDSLYGAGGGTSSDY-------------------------GAFYPR--- 60
Mouse 61 --PV--APGGAGLPAAVGSSRLGYNSYFYGQL-------HVQAAPVGPACCGAVPPLGAQQCSCV 114
Mouse 115 PTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLF 179
Mouse 180 QETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRR-QKRSSSEESENAEKWNKTSSKAS 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gsc | NP_034481.1 | Homeobox | 163..216 | CDD:278475 | 28/52 (54%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 213..256 | 11/29 (38%) | |||
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 28/51 (55%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.940 |