DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and ey

DIOPT Version :9

Sequence 1:NP_034481.1 Gene:Gsc / 14836 MGIID:95841 Length:256 Species:Mus musculus
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:257 Identity:69/257 - (26%)
Similarity:106/257 - (41%) Gaps:62/257 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 PVAPSAAAPVVFPALHGDSLYGAGGGTSSDY-------------------------GAFYPR--- 60
            |:.|:.|||:|     |.|....  ||.|.:                         |::||.   
  Fly   318 PLEPARAAPLV-----GQSPNHL--GTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLS 375

Mouse    61 --PV--APGGAGLPAAVGSSRLGYNSYFYGQL-------HVQAAPVGPACCGAVPPLGAQQCSCV 114
              |:  ||..|.:.|......|.::......:       |.:..||..........|...|....
  Fly   376 EIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDET 440

Mouse   115 PTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLF 179
            .:..|....|..            .|:|.....:.:|:.:   |:.:|:||.||::|:::||..|
  Fly   441 GSGEGENSNGGA------------SNIGNTEDDQARLILK---RKLQRNRTSFTNDQIDSLEKEF 490

Mouse   180 QETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRR-QKRSSSEESENAEKWNKTSSKAS 240
            :.|.||||..||:||.|:.|.|.:::|||.|||||||| :|..:...:.|:...:.|||..|
  Fly   491 ERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTS 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_034481.1 Homeobox 163..216 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..256 11/29 (38%)
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 28/51 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.